Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Cellulomonas fimi [TaxId:1708] [231539] (1 PDB entry) |
Domain d2x2ya2: 2x2y A:371-464 [231540] Other proteins in same PDB: d2x2ya1, d2x2ya3, d2x2yb1, d2x2yb3 automated match to d2bvta1 complexed with fmt, mg; mutant |
PDB Entry: 2x2y (more details), 2.35 Å
SCOPe Domain Sequences for d2x2ya2:
Sequence, based on SEQRES records: (download)
>d2x2ya2 b.1.18.0 (A:371-464) automated matches {Cellulomonas fimi [TaxId: 1708]} aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt apwsptsaqldnstytvtatattaagtldvtnev
>d2x2ya2 b.1.18.0 (A:371-464) automated matches {Cellulomonas fimi [TaxId: 1708]} aqpvvhiaspadgarvpttvrvrvggtdvqsvtvevaqtvvdtldlaydgalwwtapwsp stytvtatattaagtldvtnev
Timeline for d2x2ya2: