Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Zoogloea ramigera [TaxId:350] [231413] (6 PDB entries) |
Domain d2wl4b2: 2wl4 B:269-392 [231427] Other proteins in same PDB: d2wl4a1, d2wl4b1, d2wl4c1, d2wl4d1 automated match to d1m3ka2 complexed with cl, coa, na, so4; mutant |
PDB Entry: 2wl4 (more details), 1.8 Å
SCOPe Domain Sequences for d2wl4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wl4b2 c.95.1.0 (B:269-392) automated matches {Zoogloea ramigera [TaxId: 350]} iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk dlgwdpsivnvnggaiaigapigasgarilntllfemkrrgarkglatlcigggmgvamc iesl
Timeline for d2wl4b2: