Lineage for d2vyri_ (2vyr I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355251Domain d2vyri_: 2vyr I: [231366]
    Other proteins in same PDB: d2vyra_, d2vyrb_, d2vyrc_, d2vyrd_
    automated match to d1ieha_
    complexed with so4

Details for d2vyri_

PDB Entry: 2vyr (more details), 2 Å

PDB Description: Structure of human MDM4 N-terminal domain bound to a single domain antibody
PDB Compounds: (I:) human single domain antibody

SCOPe Domain Sequences for d2vyri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyri_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy
adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv
tvss

SCOPe Domain Coordinates for d2vyri_:

Click to download the PDB-style file with coordinates for d2vyri_.
(The format of our PDB-style files is described here.)

Timeline for d2vyri_: