Lineage for d1ndsb1 (1nds B:11-166)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553929Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 554017Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 554178Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (16 PDB entries)
  8. 554215Domain d1ndsb1: 1nds B:11-166 [23114]

Details for d1ndsb1

PDB Entry: 1nds (more details), 2.8 Å

PDB Description: crystallographic structure of a substrate bound blue copper nitrite reductase from alcaligenes xylosoxidans

SCOP Domain Sequences for d1ndsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndsb1 b.6.1.3 (B:11-166) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
glprvavdlvapplvhphsqvaagapkvvqfrmsieekkmvadddgttaqamtfngsvpg
ptlvvhegdyieltlvnpatnsmphnvdfhaatgalggagltqvvpgqeavlrfkadrsg
tfvyhcapagmvpwhvvsgmngalmvlprdglrdaa

SCOP Domain Coordinates for d1ndsb1:

Click to download the PDB-style file with coordinates for d1ndsb1.
(The format of our PDB-style files is described here.)

Timeline for d1ndsb1: