Lineage for d2ohjd2 (2ohj D:255-403)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465166Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2465167Protein automated matches [190158] (30 species)
    not a true protein
  7. 2465272Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries)
  8. 2465278Domain d2ohjd2: 2ohj D:255-403 [231087]
    Other proteins in same PDB: d2ohja1, d2ohjb1, d2ohjd1, d2ohje1
    automated match to d1ycfa1
    complexed with cl, fe, fmn

Details for d2ohjd2

PDB Entry: 2ohj (more details), 2.26 Å

PDB Description: Crystal Structure of coenzyme F420H2 oxidase (FprA), a diiron flavoprotein, inactive oxidized state
PDB Compounds: (D:) Type A flavoprotein fprA

SCOPe Domain Sequences for d2ohjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ohjd2 c.23.5.0 (D:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg
aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva
ceeevyyvptgdeldacfeagrklaaeir

SCOPe Domain Coordinates for d2ohjd2:

Click to download the PDB-style file with coordinates for d2ohjd2.
(The format of our PDB-style files is described here.)

Timeline for d2ohjd2: