Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (30 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [231062] (3 PDB entries) |
Domain d2ohjd2: 2ohj D:255-403 [231087] Other proteins in same PDB: d2ohja1, d2ohjb1, d2ohjd1, d2ohje1 automated match to d1ycfa1 complexed with cl, fe, fmn |
PDB Entry: 2ohj (more details), 2.26 Å
SCOPe Domain Sequences for d2ohjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohjd2 c.23.5.0 (D:255-403) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} vdervtviydtmhgstrkmahaiaegamsegvdvrvyclheddrseivkdilesgaialg aptiydepypsvgdllmylrglkfnrtltrkalvfgsmggnggatgtmkellaeagfdva ceeevyyvptgdeldacfeagrklaaeir
Timeline for d2ohjd2: