Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.14: RNA helicase [52724] (4 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
Protein automated matches [226986] (2 species) not a true protein |
Domain d2jlwa1: 2jlw A:168-482 [230927] automated match to d2bhra2 |
PDB Entry: 2jlw (more details), 2.6 Å
SCOPe Domain Sequences for d2jlwa1:
Sequence, based on SEQRES records: (download)
>d2jlwa1 c.37.1.14 (A:168-482) automated matches {Dengue virus 4 [TaxId: 408688]} gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvv aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllsstrvpnynlivmdeah ftdpcsvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntg fdwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvt tdisemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaq eddqyvfsgdplknd
>d2jlwa1 c.37.1.14 (A:168-482) automated matches {Dengue virus 4 [TaxId: 408688]} gsamgepdyevdedifrkkrltimdlhpgagktkrilpsivrealkrrlrtlilaptrvv aaemeealrglpiryqtpavksdhtgreivdlmchatfttrllstrvpnynlivmdeahf tdpcsvaargyistrvemgeaaaifmtatppgsidpfpqsnspiediereiperswntgf dwitdyqgktvwfvpsikagndianclrksgkrviqlsrktfdteypktkltdwdfvvtt disemganfragrvidprrclkpviltdgpervilagpipvtpasaaqrrgrigrnpaqe ddqyvfsgdplknd
Timeline for d2jlwa1: