Lineage for d2hwva_ (2hwv A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480304Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1480390Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1480391Protein automated matches [190858] (12 species)
    not a true protein
  7. 1480398Species Enterococcus faecalis [TaxId:226185] [230777] (1 PDB entry)
  8. 1480399Domain d2hwva_: 2hwv A: [230778]
    automated match to d2pmub_
    complexed with so4

Details for d2hwva_

PDB Entry: 2hwv (more details), 1.9 Å

PDB Description: crystal structure of an essential response regulator dna binding domain, vicrc in enterococcus faecalis, a member of the yycf subfamily.
PDB Compounds: (A:) DNA-binding response regulator VicR

SCOPe Domain Sequences for d2hwva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hwva_ a.4.6.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
shmtigdltihpdaymvskrgekielthrefellyylakhigqvmtrehllqtvwgydyf
gdvrtvdvtvrrlrekiedspshptylvtrrgvgyylrnpe

SCOPe Domain Coordinates for d2hwva_:

Click to download the PDB-style file with coordinates for d2hwva_.
(The format of our PDB-style files is described here.)

Timeline for d2hwva_: