SCOPe 2.04: Domain d2gdca1: 2gdc A:2-128

Lineage for d2gdca1 (2gdc A:2-128)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein automated matches [226863] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225109] (3 PDB entries)

8. Domain d2gdca1: 2gdc A:2-128 [230742]
   automated match to d1syqa1

Details for d2gdca1

PDB Entry: 2gdc, 2.74 Å

PDB Description: Structure of Vinculin VD1 / IpaA560-633 complex

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d2gdca1:

Sequence, based on SEQRES records:

>d2gdca1 a.24.9.1 (A:2-128) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgket
vqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgtsd
llltfde

Sequence, based on observed residues (ATOM records):

>d2gdca1 a.24.9.1 (A:2-128) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pvfhtrtiesilepvaqqishgkaipdltapvsavqaavsnlvrvgketvqttedqilkr
dmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgtsdllltfde

Timeline for d2gdca1:

• d2gdca1 first appeared in SCOPe 2.03
  
• d2gdca1 appears in SCOPe 2.05
  
• d2gdca1 appears in the current release, SCOPe 2.08