![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (156 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [226067] (7 PDB entries) |
![]() | Domain d2d3wd_: 2d3w D: [230634] automated match to d2d2ea_ |
PDB Entry: 2d3w (more details), 2.5 Å
SCOPe Domain Sequences for d2d3wd_:
Sequence, based on SEQRES records: (download)
>d2d3wd_ c.37.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]} mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg ygwl
>d2d3wd_ c.37.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]} mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdgldidal kvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqgy gwl
Timeline for d2d3wd_: