SCOPe 2.04: Domain d2bzrc1: 2bzr C:21-277

Lineage for d2bzrc1 (2bzr C:21-277)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein automated matches [226926] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [230567] (1 PDB entry)

8. Domain d2bzrc1: 2bzr C:21-277 [230572]
   automated match to d2a7sa1

Details for d2bzrc1

PDB Entry: 2bzr, 2.2 Å

PDB Description: crystal structure of accd5 (rv3280), an acyl-coa carboxylase beta-subunit from mycobacterium tuberculosis

PDB Compounds: (C:) propionyl-coa carboxylase beta chain 5

SCOPe Domain Sequences for d2bzrc1:

Sequence; same for both SEQRES and ATOM records:

>d2bzrc1 c.14.1.4 (C:21-277) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldalak
hrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqelai
ktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvyspa
ltdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdafd
yvrellsylppnnstda

Timeline for d2bzrc1:

• d2bzrc1 first appeared in SCOPe 2.03
  
• d2bzrc1 appears in SCOPe 2.05
  
• d2bzrc1 appears in the current release, SCOPe 2.08