Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
Protein automated matches [226926] (3 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [230567] (1 PDB entry) |
Domain d2bzrc1: 2bzr C:21-277 [230572] automated match to d2a7sa1 |
PDB Entry: 2bzr (more details), 2.2 Å
SCOPe Domain Sequences for d2bzrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzrc1 c.14.1.4 (C:21-277) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} dihttagklaelhkrreeslhpvgedavekvhakgkltareriyalldedsfveldalak hrstnfnlgekrplgdgvvtgygtidgrdvcifsqdatvfggslgevygekivkvqelai ktgrpligindgagariqegvvslglysrifrnnilasgvipqislimgaaagghvyspa ltdfvimvdqtsqmfitgpdviktvtgeevtmeelggahthmaksgtahyaasgeqdafd yvrellsylppnnstda
Timeline for d2bzrc1: