Lineage for d2aana_ (2aan A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382135Species Chloroflexus aurantiacus [TaxId:1108] [230491] (1 PDB entry)
  8. 2382136Domain d2aana_: 2aan A: [230492]
    automated match to d1cuoa_
    complexed with cu, so4

Details for d2aana_

PDB Entry: 2aan (more details), 1.85 Å

PDB Description: auracyanin a: a "blue" copper protein from the green thermophilic photosynthetic bacterium,chloroflexus aurantiacus
PDB Compounds: (A:) auracyanin A

SCOPe Domain Sequences for d2aana_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aana_ b.6.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 1108]}
gpvtieigskgeelafdkteltvsagqtvtirfknnsavqqhnwilvkggeaeaaniana
glsagpaanylpadksniiaesplangnetvevtftapaagtylyictvpghyplmqgkl
vvn

SCOPe Domain Coordinates for d2aana_:

Click to download the PDB-style file with coordinates for d2aana_.
(The format of our PDB-style files is described here.)

Timeline for d2aana_: