Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (23 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [230411] (1 PDB entry) |
Domain d1yb4b2: 1yb4 B:161-291 [230414] Other proteins in same PDB: d1yb4a1, d1yb4b1 automated match to d1vpda1 |
PDB Entry: 1yb4 (more details), 2.4 Å
SCOPe Domain Sequences for d1yb4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yb4b2 a.100.1.0 (B:161-291) automated matches {Salmonella typhimurium [TaxId: 99287]} gngdgqtckvanqiivalnieavsealvfaskagadpvrvrqalmggfassrilevhger minrtfepgfkialhqkdlnlalqsakalalnlpntatcqelfntcaanggsqldhsamv qalelmanhkl
Timeline for d1yb4b2: