SCOPe 2.04: Domain d1fftg1: 1fft G:118-283

Lineage for d1fftg1 (1fft G:118-283)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands
Superfamily b.6.1: Cupredoxins [49503] (8 families)
contains copper-binding site
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
Protein Quinol oxidase (CyoA) [49542] (1 species)
Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)
Domain d1fftg1: 1fft G:118-283 [23026]
Other proteins in same PDB: d1ffta_, d1fftb2, d1fftc_, d1fftf_, d1fftg2, d1ffth_
complexed with cu, hem, heo

Details for d1fftg1

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

PDB Compounds: (G:) ubiquinol oxidase

SCOPe Domain Sequences for d1fftg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftg1 b.6.1.2 (G:118-283) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma

SCOPe Domain Coordinates for d1fftg1:

Click to download the PDB-style file with coordinates for d1fftg1.
(The format of our PDB-style files is described here.)

Timeline for d1fftg1: