![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
![]() | Protein Clp protease, ClpP subunit [52098] (8 species) |
![]() | Species Staphylococcus aureus [TaxId:196620] [189881] (4 PDB entries) |
![]() | Domain d4empi_: 4emp I: [230232] automated match to d4empa_ mutant |
PDB Entry: 4emp (more details), 2.7 Å
SCOPe Domain Sequences for d4empi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4empi_ c.14.1.1 (I:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]} iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih qplggaqgqateiaiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey glidevmvp
Timeline for d4empi_: