Lineage for d4nx5a_ (4nx5 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435437Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2435583Protein automated matches [190130] (11 species)
    not a true protein
  7. 2435674Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries)
  8. 2435787Domain d4nx5a_: 4nx5 A: [230190]
    automated match to d3g1fa_
    complexed with cl, edo, gol, mg, up6

Details for d4nx5a_

PDB Entry: 4nx5 (more details), 1.59 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4nx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nx5a_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcr
iiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltem
shpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqg
gdpgetlrfadaiivgrsiyladnpaaaaagiiesikdll

SCOPe Domain Coordinates for d4nx5a_:

Click to download the PDB-style file with coordinates for d4nx5a_.
(The format of our PDB-style files is described here.)

Timeline for d4nx5a_: