SCOPe 2.07: Domain d4m7hb_: 4m7h B:

Lineage for d4m7hb_ (4m7h B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.0: automated matches [191465] (1 protein)
   not a true family

6. Protein automated matches [190726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187887] (49 PDB entries)

8. Domain d4m7hb_: 4m7h B: [230155]
   automated match to d4m7fb_
   complexed with acy, ca, gol, nag, so4

Details for d4m7hb_

PDB Entry: 4m7h, 2 Å

PDB Description: crystal structure of tetrameric fibrinogen-like recognition domain of fibcd1

PDB Compounds: (B:) Fibrinogen C domain-containing protein 1

SCOPe Domain Sequences for d4m7hb_:

Sequence; same for both SEQRES and ATOM records:

>d4m7hb_ d.171.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srprdcldvllsgqqddgvysvfpthypagfqvycdmrtdgggwtvfqrredgsvnffrg
wdayrdgfgrltgehwlglkrihalttqaayelhvdledfengtayarygsfgvglfsvd
peedgypltvadysgtagdsllkhsgmrfttkdrdsdhsenncaafyrgawwyrnchtsn
lngqylrgahasyadgvewsswtgwqyslkfsemkirpv

Timeline for d4m7hb_:

• d4m7hb_ first appeared in SCOPe 2.03
  
• d4m7hb_ appears in SCOPe 2.06
  
• d4m7hb_ appears in the current release, SCOPe 2.08