Lineage for d1joi__ (1joi -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Azurin [49530] (6 species) 
Species Pseudomonas fluorescens [TaxId:294] [49534] (1 PDB entry) 
Domain d1joi__: 1joi - [23010]
Details for d1joi__
PDB Entry: 1joi (more details), 2.05 Å
PDB Description: structure of pseudomonas fluorescens holo azurin
SCOP Domain Sequences for d1joi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1joi__ b.6.1.1 (-) Azurin {Pseudomonas fluorescens}
aeckvtvdstdqmsfntkaieidkscktftvelthsgslpknvmghnwvlssaadmpgia
sdgmaagidknylkegdtrviahtkiigagekdsvtfdvsklaagtdyaffcsfpghism
mkgtvtvk
SCOP Domain Coordinates for d1joi__:
Click to download the PDB-style file with coordinates for d1joi__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1joi__:
- d1joi__ first appeared (with stable ids) in SCOP 1.55
- d1joi__ appears in SCOP 1.59
- d1joi__ appears in the current release, SCOPe 2.08, called d1joia_
View in 3D