![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) mono-domain proteins |
![]() | Protein Azurin [49530] (6 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries) |
![]() | Domain d1ag0b_: 1ag0 B: [23002] complexed with cu; mutant |
PDB Entry: 1ag0 (more details), 2.4 Å
SCOP Domain Sequences for d1ag0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ag0b_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa} aaecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgv vtdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffdtfpghsa lmkgtltlk
Timeline for d1ag0b_: