Lineage for d2tsad_ (2tsa D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 55952Protein Azurin [49530] (6 species)
  7. 55981Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries)
  8. 56055Domain d2tsad_: 2tsa D: [22994]

Details for d2tsad_

PDB Entry: 2tsa (more details), 2.2 Å

PDB Description: azurin mutant m121a

SCOP Domain Sequences for d2tsad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tsad_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
akgtltlk

SCOP Domain Coordinates for d2tsad_:

Click to download the PDB-style file with coordinates for d2tsad_.
(The format of our PDB-style files is described here.)

Timeline for d2tsad_: