Lineage for d4igub_ (4igu B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275178Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1275179Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1275237Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 1275238Protein automated matches [190464] (2 species)
    not a true protein
  7. 1275239Species Drosophila melanogaster [TaxId:7227] [229827] (1 PDB entry)
  8. 1275241Domain d4igub_: 4igu B: [229828]
    automated match to d2af0a_
    complexed with cl, edo, na

Details for d4igub_

PDB Entry: 4igu (more details), 1.9 Å

PDB Description: Crystal structure of the RGS domain of CG5036
PDB Compounds: (B:) cg5036

SCOPe Domain Sequences for d4igub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4igub_ a.91.1.0 (B:) automated matches {Drosophila melanogaster [TaxId: 7227]}
sqptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlacedlkkenspelve
ekarliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiytlmhrdsyprf
lnsqkfktlsrpaakln

SCOPe Domain Coordinates for d4igub_:

Click to download the PDB-style file with coordinates for d4igub_.
(The format of our PDB-style files is described here.)

Timeline for d4igub_: