SCOPe 2.07: Domain d4ft8b1: 4ft8 B:7-137

Lineage for d4ft8b1 (4ft8 B:7-137)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (31 PDB entries)

8. Domain d4ft8b1: 4ft8 B:7-137 [229809]
   Other proteins in same PDB: d4ft8a2, d4ft8b2
   automated match to d1i5za2
   complexed with cmp, co, so4

Details for d4ft8b1

PDB Entry: 4ft8, 1.97 Å

PDB Description: E. coli Catabolite Activator Protein with Cobalt and Sulfate Ligands

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d4ft8b1:

Sequence; same for both SEQRES and ATOM records:

>d4ft8b1 b.82.3.2 (B:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekvgnlafl

Timeline for d4ft8b1:

• d4ft8b1 first appeared in SCOPe 2.03
  
• d4ft8b1 appears in SCOPe 2.06
  
• d4ft8b1 appears in the current release, SCOPe 2.08