Lineage for d4chza_ (4chz A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374020Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 1374128Protein automated matches [190209] (5 species)
    not a true protein
  7. 1374129Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (62 PDB entries)
  8. 1374195Domain d4chza_: 4chz A: [229798]
    automated match to d4ah9a_
    complexed with act, cl, edo, h75, lys, so4

Details for d4chza_

PDB Entry: 4chz (more details), 1.8 Å

PDB Description: interrogating hiv integrase for compounds that bind- a sampl challenge
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4chza_:

Sequence, based on SEQRES records: (download)

>d4chza_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkggiggysagerivdiiatdiqt

Sequence, based on observed residues (ATOM records): (download)

>d4chza_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnhkrkgysagerivdiiatdiqt

SCOPe Domain Coordinates for d4chza_:

Click to download the PDB-style file with coordinates for d4chza_.
(The format of our PDB-style files is described here.)

Timeline for d4chza_: