Lineage for d1iluh_ (1ilu H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 55952Protein Azurin [49530] (6 species)
  7. 55981Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries)
  8. 56039Domain d1iluh_: 1ilu H: [22978]

Details for d1iluh_

PDB Entry: 1ilu (more details), 2.3 Å

PDB Description: x-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d1iluh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iluh_ b.6.1.1 (H:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymsfctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1iluh_:

Click to download the PDB-style file with coordinates for d1iluh_.
(The format of our PDB-style files is described here.)

Timeline for d1iluh_: