Lineage for d4ixub_ (4ixu B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2481833Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2481854Protein Arginase [52770] (5 species)
  7. 2481966Species Human (Homo sapiens), isoform II, mitochondrial [TaxId:9606] [102412] (9 PDB entries)
  8. 2481974Domain d4ixub_: 4ixu B: [229625]
    automated match to d1pq3a_
    complexed with 38i, ben, bme, mn

Details for d4ixub_

PDB Entry: 4ixu (more details), 1.9 Å

PDB Description: Crystal structure of human Arginase-2 complexed with inhibitor 11d: {(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)
PDB Compounds: (B:) Arginase-2, mitochondrial

SCOPe Domain Sequences for d4ixub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixub_ c.42.1.1 (B:) Arginase {Human (Homo sapiens), isoform II, mitochondrial [TaxId: 9606]}
hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
gqtreg

SCOPe Domain Coordinates for d4ixub_:

Click to download the PDB-style file with coordinates for d4ixub_.
(The format of our PDB-style files is described here.)

Timeline for d4ixub_: