SCOP 1.67: Domain d1ilsb_: 1ils B:

Lineage for d1ilsb_ (1ils B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (33 PDB entries)

8. Domain d1ilsb_: 1ils B: [22956]

Details for d1ilsb_

PDB Entry: 1ils, 2.2 Å

PDB Description: x-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d1ilsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ilsb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aecsvdsqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d1ilsb_:

• d1ilsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ilsb_ appears in SCOP 1.65
  
• d1ilsb_ appears in SCOP 1.69
  
• d1ilsb_ appears in the current release, SCOPe 2.08