Lineage for d4kgvb1 (4kgv B:9-100)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556379Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 2556380Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 2556381Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 2556382Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
    Uniprot P00478
  8. 2556391Domain d4kgvb1: 4kgv B:9-100 [229275]
    Other proteins in same PDB: d4kgva1, d4kgva2, d4kgvb2, d4kgvc1, d4kgvc2, d4kgvd2
    automated match to d2fzcb1
    complexed with atp, pal, zn

Details for d4kgvb1

PDB Entry: 4kgv (more details), 2.1 Å

PDB Description: The R state structure of E. coli ATCase with ATP bound
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4kgvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgvb1 d.58.2.1 (B:9-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
veaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflse
dqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d4kgvb1:

Click to download the PDB-style file with coordinates for d4kgvb1.
(The format of our PDB-style files is described here.)

Timeline for d4kgvb1: