SCOP 1.67: Domain d2azud_: 2azu D:

Lineage for d2azud_ (2azu D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (33 PDB entries)

8. Domain d2azud_: 2azu D: [22926]
   complexed with cu, no3; mutant

Details for d2azud_

PDB Entry: 2azu, 1.9 Å

PDB Description: x-ray crystal structure of the two site-specific mutants his35*gln and his35*leu of azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d2azud_:

Sequence; same for both SEQRES and ATOM records:

>d2azud_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
aqcsvdiqgndqmqfntnaitvdksckqftvnlslpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d2azud_:

• d2azud_ first appeared (with stable ids) in SCOP 1.55
  
• d2azud_ appears in SCOP 1.65
  
• d2azud_ appears in SCOP 1.69
  
• d2azud_ appears in the current release, SCOPe 2.08