Lineage for d1aizb_ (1aiz B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 55952Protein Azurin [49530] (6 species)
  7. 55953Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 55959Domain d1aizb_: 1aiz B: [22904]

Details for d1aizb_

PDB Entry: 1aiz (more details), 1.8 Å

PDB Description: structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution

SCOP Domain Sequences for d1aizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aizb_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn

SCOP Domain Coordinates for d1aizb_:

Click to download the PDB-style file with coordinates for d1aizb_.
(The format of our PDB-style files is described here.)

Timeline for d1aizb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aiza_