SCOPe 2.08: Domain d3vz7a1: 3vz7 A:185-376

Lineage for d3vz7a1 (3vz7 A:185-376)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein automated matches [191245] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [229023] (2 PDB entries)

8. Domain d3vz7a1: 3vz7 A:185-376 [229027]
   Other proteins in same PDB: d3vz7a2
   automated match to d1la1a_

Details for d3vz7a1

PDB Entry: 3vz7, 1.8 Å

PDB Description: Crystal Structure Analysis of the mini-chaperonin variant with Pro 187 Gly

PDB Compounds: (A:) 60 kda chaperonin

SCOPe Domain Sequences for d3vz7a1:

Sequence; same for both SEQRES and ATOM records:

>d3vz7a1 c.8.5.1 (A:185-376) automated matches {Escherichia coli [TaxId: 562]}
lvgrgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakag
kplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvisee
igmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrek
lqervaklaggv

Timeline for d3vz7a1:

• d3vz7a1 first appeared in SCOPe 2.03, called d3vz7a_
  
• d3vz7a1 was called d3vz7a_ in SCOPe 2.07