Lineage for d1azca_ (1azc A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 292711Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 292712Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 292713Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 292739Protein Azurin [49530] (6 species)
  7. 292740Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 292741Domain d1azca_: 1azc A: [22899]

Details for d1azca_

PDB Entry: 1azc (more details), 1.8 Å

PDB Description: structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution

SCOP Domain Sequences for d1azca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azca_ b.6.1.1 (A:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn

SCOP Domain Coordinates for d1azca_:

Click to download the PDB-style file with coordinates for d1azca_.
(The format of our PDB-style files is described here.)

Timeline for d1azca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1azcb_