Lineage for d2cbp__ (2cbp -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Plantacyanin [49527] (2 species) Species Cucumber (Cucumis sativus) [TaxId:3659] [49528] (1 PDB entry) 
Domain d2cbp__: 2cbp - [22895]
Details for d2cbp__
PDB Entry: 2cbp (more details), 1.8 Å
PDB Description: cucumber basic protein, a blue copper protein
SCOP Domain Sequences for d2cbp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbp__ b.6.1.1 (-) Plantacyanin {Cucumber (Cucumis sativus)}
avyvvggsggwtfnteswpkgkrfragdillfnynpsmhnvvvvnqggfstcntpagakv
ytsgrdqiklpkgqsyficnfpghcqsgmkiavnal
SCOP Domain Coordinates for d2cbp__:
Click to download the PDB-style file with coordinates for d2cbp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cbp__:
- d2cbp__ first appeared (with stable ids) in SCOP 1.55
- d2cbp__ appears in SCOP 1.59
- d2cbp__ appears in the current release, SCOPe 2.08, called d2cbpa_
View in 3D