Lineage for d1pzba_ (1pzb A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380714Protein Pseudoazurin [49522] (4 species)
  7. 2380737Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (14 PDB entries)
    Uniprot P04377
  8. 2380747Domain d1pzba_: 1pzb A: [22883]
    complexed with cu

Details for d1pzba_

PDB Entry: 1pzb (more details), 1.8 Å

PDB Description: the crystal structures of reduced pseudoazurin from alcaligenes faecalis s-6 at two ph values
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d1pzba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzba_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia

SCOPe Domain Coordinates for d1pzba_:

Click to download the PDB-style file with coordinates for d1pzba_.
(The format of our PDB-style files is described here.)

Timeline for d1pzba_: