Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (14 species) not a true protein |
Species Influenza A virus [TaxId:11320] [228462] (9 PDB entries) |
Domain d4lkge_: 4lkg E: [228796] Other proteins in same PDB: d4lkgb_, d4lkgd_, d4lkgf_ automated match to d1rvxa_ complexed with nag |
PDB Entry: 4lkg (more details), 2.99 Å
SCOPe Domain Sequences for d4lkge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkge_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]} dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv kqrslllatgmknvpe
Timeline for d4lkge_: