SCOPe 2.04: Domain d4lkge_: 4lkg E:

Lineage for d4lkge_ (4lkg E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (14 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [228462] (9 PDB entries)

8. Domain d4lkge_: 4lkg E: [228796]
   Other proteins in same PDB: d4lkgb_, d4lkgd_, d4lkgf_
   automated match to d1rvxa_
   complexed with nag

Details for d4lkge_

PDB Entry: 4lkg, 2.99 Å

PDB Description: the structure of hemagglutinin from a avian-origin h7n9 influenza virus (a/shanghai/1/2013) in complex with avian receptor analog 3'slnln

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4lkge_:

Sequence; same for both SEQRES and ATOM records:

>d4lkge_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

Timeline for d4lkge_:

• d4lkge_ first appeared in SCOPe 2.03
  
• d4lkge_ appears in SCOPe 2.05
  
• d4lkge_ appears in the current release, SCOPe 2.08