Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Plastocyanin [49507] (17 species) |
Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (3 PDB entries) |
Domain d1b3ia_: 1b3i A: [22877] complexed with cu1 |
PDB Entry: 1b3i (more details)
SCOPe Domain Sequences for d1b3ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3ia_ b.6.1.1 (A:) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl aiapgsfysvtlgtpgtysfyctphrgagmvgtitve
Timeline for d1b3ia_: