Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein automated matches [190140] (13 species) not a true protein |
Domain d4ki0e_: 4ki0 E: [228485] Other proteins in same PDB: d4ki0a1, d4ki0a2, d4ki0b1, d4ki0b2, d4ki0f1, d4ki0f2, d4ki0g_ automated match to d3rlfe_ complexed with anp, mg, pgv, umq |
PDB Entry: 4ki0 (more details), 2.38 Å
SCOPe Domain Sequences for d4ki0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ki0e_ c.94.1.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea lkdaqtritk
Timeline for d4ki0e_: