Lineage for d4ki0e_ (4ki0 E:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1390578Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1391375Protein automated matches [190140] (13 species)
    not a true protein
  7. Species Escherichia coli K-12 [TaxId:83333] [189211] (11 PDB entries)
  8. 1391433Domain d4ki0e_: 4ki0 E: [228485]
    Other proteins in same PDB: d4ki0a1, d4ki0a2, d4ki0b1, d4ki0b2, d4ki0f1, d4ki0f2, d4ki0g_
    automated match to d3rlfe_
    complexed with anp, mg, pgv, umq

Details for d4ki0e_

PDB Entry: 4ki0 (more details), 2.38 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
PDB Compounds: (E:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d4ki0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ki0e_ c.94.1.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritk

SCOPe Domain Coordinates for d4ki0e_:

Click to download the PDB-style file with coordinates for d4ki0e_.
(The format of our PDB-style files is described here.)

Timeline for d4ki0e_: