Lineage for d4c2mj_ (4c2m J:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260703Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 1260704Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1260705Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 1260706Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (28 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1260710Domain d4c2mj_: 4c2m J: [228428]
    Other proteins in same PDB: d4c2m1_, d4c2me1, d4c2me2, d4c2mf_, d4c2mh_, d4c2ml_, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mw_
    automated match to d1twfj_
    complexed with so4, zn

Details for d4c2mj_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit rpabc 5

SCOPe Domain Sequences for d4c2mj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynplekr

SCOPe Domain Coordinates for d4c2mj_:

Click to download the PDB-style file with coordinates for d4c2mj_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mj_: