Lineage for d4bqja_ (4bqj A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429695Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1429696Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1429697Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1429864Protein automated matches [190229] (8 species)
    not a true protein
  7. 1429877Species Human (Homo sapiens) [TaxId:9606] [187292] (58 PDB entries)
  8. 1429939Domain d4bqja_: 4bqj A: [228422]
    automated match to d4b7pa_
    complexed with xkl

Details for d4bqja_

PDB Entry: 4bqj (more details), 2 Å

PDB Description: structure of hsp90 with an inhibitor bound
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d4bqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bqja_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskld
sgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismi
gqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlk
edqteyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d4bqja_:

Click to download the PDB-style file with coordinates for d4bqja_.
(The format of our PDB-style files is described here.)

Timeline for d4bqja_: