Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries) |
Domain d4l8ba1: 4l8b A:1-181 [228362] Other proteins in same PDB: d4l8ba2, d4l8bb_ automated match to d1n3na2 complexed with na, peg, so4 |
PDB Entry: 4l8b (more details), 2.2 Å
SCOPe Domain Sequences for d4l8ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l8ba1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d4l8ba1: