Lineage for d4marb_ (4mar B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1608177Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1608995Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 1608996Protein automated matches [190781] (30 species)
    not a true protein
  7. 1609099Species Meiothermus ruber [TaxId:504728] [224901] (2 PDB entries)
  8. 1609104Domain d4marb_: 4mar B: [228247]
    automated match to d4m3na_
    complexed with mg, so4

Details for d4marb_

PDB Entry: 4mar (more details), 2.16 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase from Meiothermus ruber DSM 1279 complexed with sulfate.
PDB Compounds: (B:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4marb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4marb_ c.56.2.0 (B:) automated matches {Meiothermus ruber [TaxId: 504728]}
tphisappgavaeaillpgdplrakyiaenflenpvlynqvrnmfgytgtykgkrvsvqg
tgmgipsasiyihelvqfygcktlirvgtagaiterlklrdlviaqaactdssinnlrfa
gqnyapiatfdllrrayeqaqsrgmpvhvgnvlstdtfyhdqpnpyqlwaqfgvlaveme
aaglytlaakfgvqalciltisdhlitgekttpqerqetfdqmievaleti

SCOPe Domain Coordinates for d4marb_:

Click to download the PDB-style file with coordinates for d4marb_.
(The format of our PDB-style files is described here.)

Timeline for d4marb_: