SCOPe 2.08: Domain d4bx5c_: 4bx5 C:

Lineage for d4bx5c_ (4bx5 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d4bx5c_: 4bx5 C: [228156]
   Other proteins in same PDB: d4bx5b_, d4bx5d_
   automated match to d4jnja_
   complexed with edo, pg4

Details for d4bx5c_

PDB Entry: 4bx5, 1.43 Å

PDB Description: cis-divalent streptavidin

PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d4bx5c_:

Sequence, based on SEQRES records:

>d4bx5c_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwyaqlgdtfivtagadgaltgtyeaavgdddgdddgdddgaesryvltgryds
apatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawks
tlvghdtftkvk

Sequence, based on observed residues (ATOM records):

>d4bx5c_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwyaqlgdtfivtagadgaltgtyeaagaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Timeline for d4bx5c_:

• d4bx5c_ first appeared in SCOPe 2.03
  
• d4bx5c_ appears in SCOPe 2.07