Lineage for d4klbc_ (4klb C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2533758Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2533982Protein Cruzain [54020] (1 species)
  7. 2533983Species Trypanosoma cruzi [TaxId:5693] [54021] (28 PDB entries)
  8. 2534022Domain d4klbc_: 4klb C: [227972]
    automated match to d1me4a_
    complexed with 1rv

Details for d4klbc_

PDB Entry: 4klb (more details), 2.62 Å

PDB Description: crystal structure of cruzain in complex with the non-covalent inhibitor nequimed176
PDB Compounds: (C:) Cruzipain

SCOPe Domain Sequences for d4klbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4klbc_ d.3.1.1 (C:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

SCOPe Domain Coordinates for d4klbc_:

Click to download the PDB-style file with coordinates for d4klbc_.
(The format of our PDB-style files is described here.)

Timeline for d4klbc_: