Lineage for d4hwta2 (4hwt A:645-752)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489766Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2489767Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2489886Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 2489887Protein automated matches [227930] (6 species)
    not a true protein
  7. 2489907Species Human (Homo sapiens) [TaxId:9606] [227931] (3 PDB entries)
  8. 2489908Domain d4hwta2: 4hwt A:645-752 [227932]
    Other proteins in same PDB: d4hwta1, d4hwtb1
    automated match to d1qf6a1
    protein/RNA complex; complexed with 1b2, zn

Details for d4hwta2

PDB Entry: 4hwt (more details), 2.3 Å

PDB Description: Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (A:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4hwta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwta2 c.51.1.0 (A:645-752) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpfwlsprqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqyn
filvvgekekisgtvnirtrdnkvhgertisetierlqqlkefrskqa

SCOPe Domain Coordinates for d4hwta2:

Click to download the PDB-style file with coordinates for d4hwta2.
(The format of our PDB-style files is described here.)

Timeline for d4hwta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hwta1