Lineage for d3pciq_ (3pci Q:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2379895Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 2379910Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 2379969Domain d3pciq_: 3pci Q: [22788]
    Other proteins in same PDB: d3pcia_, d3pcib_, d3pcic_, d3pcid_, d3pcie_, d3pcif_
    complexed with bme, fe, ihb

Details for d3pciq_

PDB Entry: 3pci (more details), 2.21 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3-iodo-4-hydroxybenzoate
PDB Compounds: (Q:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pciq_:

Sequence, based on SEQRES records: (download)

>d3pciq_ b.3.6.1 (Q:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pciq_ b.3.6.1 (Q:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pciq_:

Click to download the PDB-style file with coordinates for d3pciq_.
(The format of our PDB-style files is described here.)

Timeline for d3pciq_: