Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein automated matches [190206] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186959] (16 PDB entries) |
Domain d4ipga_: 4ipg A: [227866] automated match to d4ijha_ mutant |
PDB Entry: 4ipg (more details), 1.58 Å
SCOPe Domain Sequences for d4ipga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ipga_ b.40.4.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmla tqlnplveeeqlssncvcqihrfivntlkdgrrvvilmelrvlksaeavgvkignpvpyn e
Timeline for d4ipga_: