Lineage for d4l1qe_ (4l1q E:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704092Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1704093Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1704094Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1704115Protein automated matches [190303] (3 species)
    not a true protein
  7. 1704147Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1704169Domain d4l1qe_: 4l1q E: [227758]
    automated match to d3l4oc_
    complexed with ca, edo, hec, mes, na

Details for d4l1qe_

PDB Entry: 4l1q (more details), 1.92 Å

PDB Description: Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4l1qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l1qe_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d4l1qe_:

Click to download the PDB-style file with coordinates for d4l1qe_.
(The format of our PDB-style files is described here.)

Timeline for d4l1qe_: