Lineage for d4jvla_ (4jvl A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594194Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 1594208Protein Estrogen sulfotransferase (STE, sult1e1) [52576] (2 species)
  7. 1594209Species Human (Homo sapiens) [TaxId:9606] [75198] (5 PDB entries)
  8. 1594214Domain d4jvla_: 4jvl A: [227731]
    automated match to d1hy3a_
    complexed with a3p, edo, est, na

Details for d4jvla_

PDB Entry: 4jvl (more details), 1.94 Å

PDB Description: Crystal structure of human estrogen sulfotransferase (SULT1E1) in complex with inactive cofactor PAP and estradiol (E2)
PDB Compounds: (A:) estrogen sulfotransferase

SCOPe Domain Sequences for d4jvla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jvla_ c.37.1.5 (A:) Estrogen sulfotransferase (STE, sult1e1) {Human (Homo sapiens) [TaxId: 9606]}
nseldyyekfeevhgilmykdfvkywdnveafqarpddlviatypksgttwvseivymiy
kegdvekckedvifnripflecrkenlmngvkqldemnsprivkthlppellpasfwekd
ckiiylcrnakdvavsfyyfflmvaghpnpgsfpefvekfmqgqvpygswykhvkswwek
gksprvlflfyedlkedirkeviklihflerkpseelvdriihhtsfqemknnpstnytt
lpdeimnqklspfmrkgitgdwknhftealnekfdkhyeqqmkestlkfrte

SCOPe Domain Coordinates for d4jvla_:

Click to download the PDB-style file with coordinates for d4jvla_.
(The format of our PDB-style files is described here.)

Timeline for d4jvla_: