Lineage for d4kdme_ (4kdm E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305775Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)
  8. 1305858Domain d4kdme_: 4kdm E: [227554]
    automated match to d4kpsa_
    complexed with nag

Details for d4kdme_

PDB Entry: 4kdm (more details), 2.5 Å

PDB Description: crystal structure of the hemagglutinin of ferret-transmissible h5n1 virus
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4kdme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdme_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4kdme_:

Click to download the PDB-style file with coordinates for d4kdme_.
(The format of our PDB-style files is described here.)

Timeline for d4kdme_: