SCOPe 2.03: Domain d4fh8f_: 4fh8 F:

Lineage for d4fh8f_ (4fh8 F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (15 species)
   not a true protein

7. Species Ancylostoma ceylanicum [TaxId:53326] [197299] (1 PDB entry)

8. Domain d4fh8f_: 4fh8 F: [227476]
   automated match to d4fh8d_

Details for d4fh8f_

PDB Entry: 4fh8, 2.11 Å

PDB Description: Crystal Structure of Peroxiredoxin-1 from the human hookworm Ancylostoma ceylanicum

PDB Compounds: (F:) AcePrx-1

SCOPe Domain Sequences for d4fh8f_:

Sequence; same for both SEQRES and ATOM records:

>d4fh8f_ c.47.1.10 (F:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
hmskafigkpapdfatkavfdgdfvdvklsdykgkyvvlffypldftfvcpteiiafsdr
fpefknlnvavlacstdsvfshlawintprkhgglgdmkipvladtnhqiakdygvlkdd
egiayrglfiidpkgilrqitindlpvgrsvdetlrlvqafqytdkhgev

Timeline for d4fh8f_:

• d4fh8f_ is new in SCOPe 2.03-stable
  
• d4fh8f_ appears in SCOPe 2.04
  
• d4fh8f_ appears in the current release, SCOPe 2.08, called d4fh8f1