Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (15 species) not a true protein |
Species Ancylostoma ceylanicum [TaxId:53326] [197299] (1 PDB entry) |
Domain d4fh8f_: 4fh8 F: [227476] automated match to d4fh8d_ |
PDB Entry: 4fh8 (more details), 2.11 Å
SCOPe Domain Sequences for d4fh8f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fh8f_ c.47.1.10 (F:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]} hmskafigkpapdfatkavfdgdfvdvklsdykgkyvvlffypldftfvcpteiiafsdr fpefknlnvavlacstdsvfshlawintprkhgglgdmkipvladtnhqiakdygvlkdd egiayrglfiidpkgilrqitindlpvgrsvdetlrlvqafqytdkhgev
Timeline for d4fh8f_: