Lineage for d2nyya2 (2nyy A:548-872)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2592663Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2592677Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 2592678Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 2592679Protein Botulinum neurotoxin [58093] (2 species)
  7. 2592680Species Clostridium botulinum, serotype A [TaxId:1491] [58094] (3 PDB entries)
  8. 2592683Domain d2nyya2: 2nyy A:548-872 [227308]
    Other proteins in same PDB: d2nyya1, d2nyya3, d2nyya4, d2nyyc1, d2nyyc2, d2nyyd1, d2nyyd2, d2nyyd3
    automated match to d3btaa4
    complexed with ca, zn

Details for d2nyya2

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d2nyya2:

Sequence, based on SEQRES records: (download)

>d2nyya2 h.4.2.1 (A:548-872) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
ytmfhylraqefehgksrialtnsvneallnpsrvytffssdyvkkvnkateaamflgwv
eqlvydftdetsevsttdkiaditiiipyigpalnignmlykddfvgalifsgavillef
ipeiaipvlgtfalvsyiankvltvqtidnalskrnekwdevykyivtnwlakvntqidl
irkkmkealenqaeatkaiinyqynqyteeeknninfniddlssklnesinkamininkf
lnqcsvsylmnsmipygvkrledfdaslkdallkyiydnrgtligqvdrlkdkvnntlst
dipfqlskyvdnqrllstfteyikn

Sequence, based on observed residues (ATOM records): (download)

>d2nyya2 h.4.2.1 (A:548-872) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
ytmfhylraqefehgksrialtnsvneallnpsrvytffssdyvkkvnkateaamflgwv
eqlvydftdetsevsiaditiiipyigpalnignmlykddfvgalifsgavillefipei
aipvlgtfalvsyiankvltvqtidnalskrnekwdevykyivtnwlakvntqidlirkk
mkealenqaeatkaiinyqynqyteeeknninfniddlssklnesinkamininkflnqc
svsylmnsmipygvkrledfdaslkdallkyiydnrgtligqvdrlkdkvnntlstdipf
qlskyvdnqrllstfteyikn

SCOPe Domain Coordinates for d2nyya2:

Click to download the PDB-style file with coordinates for d2nyya2.
(The format of our PDB-style files is described here.)

Timeline for d2nyya2: