Lineage for d3pchf_ (3pch F:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1302191Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1302192Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1302215Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 1302223Species Pseudomonas putida [TaxId:303] [49487] (31 PDB entries)
  8. 1302280Domain d3pchf_: 3pch F: [22658]
    Other proteins in same PDB: d3pchm_, d3pchn_, d3pcho_, d3pchp_, d3pchq_, d3pchr_
    complexed with bme, chb, fe

Details for d3pchf_

PDB Entry: 3pch (more details), 2.05 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3-chloro-4-hydroxybenzoate
PDB Compounds: (F:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pchf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pchf_ b.3.6.1 (F:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3pchf_:

Click to download the PDB-style file with coordinates for d3pchf_.
(The format of our PDB-style files is described here.)

Timeline for d3pchf_: